PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA030217-PA
Common NameOsI_30408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 210aa    MW: 23180.7 Da    PI: 10.7864
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA030217-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.31.5e-212471249
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                      rie++  rqv fskRr+g +KKA+ELS+LC a+va ++fs+ gk y +
  BGIOSGA030217-PA 24 RIESEEARQVCFSKRRAGFFKKASELSILCSADVAAVVFSPAGKAYSF 71
                      8*******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.02E-271588IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.1561575IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-301574IPR002100Transcription factor, MADS-box
CDDcd002656.26E-381687No hitNo description
PRINTSPR004043.4E-201737IPR002100Transcription factor, MADS-box
PfamPF003193.2E-252471IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-203752IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-205273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVMVTAAAAR RRPSLGRQKI EIRRIESEEA RQVCFSKRRA GFFKKASELS ILCSADVAAV  60
VFSPAGKAYS FGHPSVEFLL DRFLSSSLPA TAGKEEGSSV SVVAELNRQY GELRAMVDAH  120
KARRERAEKT MEKQRQRQPA AWMDPEAEVG RMAPEELMAL GTKLVAVQGG VAARADQMLR  180
DALLLGRRPN TTTTTTTRAP PGFFHLHPHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057890.0AP005789.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0563F09.
GenBankAP0058840.0AP005884.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0598D02.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611069.11e-152PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLB8BCY81e-152B8BCY8_ORYSI; Putative uncharacterized protein
TrEMBLQ6YTZ91e-152Q6YTZ9_ORYSJ; MADS-box protein-like
STRINGBGIOSGA030217-PA1e-152(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.17e-26AGAMOUS-like 61